PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo3G0024000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 376aa    MW: 41595.8 Da    PI: 5.5027
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo3G0024000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.46.8e-103073412155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     + +yp++ee+++LA+ +gL+++q+ +WF N+R ++
  Spipo3G0024000 307 RWPYPTEEEKTKLAEVTGLDQKQINNWFINQRKRH 341
                     569*****************************885 PP

2ELK34.54.3e-12261282122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++LlrKYs yL+sLk+EF+
  Spipo3G0024000 261 ELKEMLLRKYSAYLSSLKKEFL 282
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012550.01367116IPR005540KNOX1
PfamPF037906.3E-86992IPR005540KNOX1
SMARTSM0125516120152IPR005540KNOX1
SMARTSM012566.1E-24155206IPR005541KNOX2
PfamPF037912.7E-23159205IPR005541KNOX2
SMARTSM011881300164184IPR005539ELK domain
PROSITE profilePS5121310.72261281IPR005539ELK domain
PfamPF037893.2E-9261282IPR005539ELK domain
SMARTSM011883.4E-6261282IPR005539ELK domain
PROSITE profilePS5007113.135281344IPR001356Homeobox domain
SuperFamilySSF466891.71E-19283349IPR009057Homeodomain-like
SMARTSM003894.5E-14283348IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-26286346IPR009057Homeodomain-like
CDDcd000862.67E-13293345No hitNo description
PfamPF059202.4E-17301340IPR008422Homeobox KN domain
PROSITE patternPS000270319342IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MEDLYSIHPG IAHSDDAAVG TMSDSDSTLF HTDASSAAAL HRKVHGGERV PRELLGASTS  60
SASDLSDVVK TQISRHPRFP ALVSAYIDCR KVKYSASLFA KSIVPPLDCN LRLFSPGYYY  120
TCLLCRFSSW KQVGAPPEVA SLLEEIRRGN YPIAACSEVG TDPELDEFME SYCEVLHRFK  180
EELSKPFDEA TSFLSSIEVQ LSDLCRITAP APAAASQSTT TTATATSAGE GGGSVEEEEP  240
SSEEAEATES QETAPRMGDQ ELKEMLLRKY SAYLSSLKKE FLKKRKKGKL PKDARMELMA  300
WWKTHYRWPY PTEEEKTKLA EVTGLDQKQI NNWFINQRKR HWKPSEDMRS ALLEGVAGGS  360
GGNAVLYMDT RTVDP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276285LKKEFLKKRK
2282286KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBMTransfer from GRMZM2G087741Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545470.0AC254547.1 Spirodela polyrhiza clone GNAS837-G21, complete sequence.
GenBankAC2545590.0AC254559.1 Spirodela polyrhiza clone GNAS837-J05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008781110.11e-119PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP296e-98KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0E3TKF51e-118A0A0E3TKF5_9ERIC; Knotted-like 6 protein
STRINGGSMUA_Achr8P10550_0011e-109(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.22e-63KNOTTED1-like homeobox gene 6